PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00092.1.g00880.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 406aa    MW: 43314.2 Da    PI: 8.4814
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00092.1.g00880.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like993.2e-31234289156
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                   kpr++W+peLH+rF++a+ qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Zjn_sc00092.1.g00880.1.sm.mk 234 KPRRCWAPELHRRFLQALLQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 289
                                   79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.647231291IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-28231292IPR009057Homeodomain-like
SuperFamilySSF466894.63E-17232292IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-26234289IPR006447Myb domain, plants
PfamPF002491.7E-5236287IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MEMDPPPPSL HAAAAAGDRR RCREYLLALE EERRKIQVFQ RELPLCLDLV TQTIERMKSQ  60
MDGVGSEVTV SDHGPVLEEF MPLKPIRSLS SSEEHDSSRD ASGGVGRKEE AADTPAETKK  120
ATPDWLQSVQ LWSQEPQQRS ASHPHKELPC KPVALNARKS GGAFQPFEKE KRVELPASST  180
TAAASSTVAG DSGDDDKGAS VDTEKRSGEK ETSTNKDAKG AKDKEGQSSS SSRKPRRCWA  240
PELHRRFLQA LLQLGGSHVA TPKQIRELMK VDGLTNDEVK SHLQKYRLHT RRPNSTGQSS  300
SASAAPPAPQ FVVVGGIWVP PPEYAAAAAA AAAAQPPVQQ LTADTSGGAS TVYAPVATLP  360
SGLQPRSQQL VKKQPSRCSD GQRSGSAGET SSASPAVSSS SQTSSA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954868.21e-169PREDICTED: uncharacterized protein LOC101769398
TrEMBLA0A0A9G3F30.0A0A0A9G3F3_ARUDO; Uncharacterized protein
STRINGSi019945m1e-169(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64703754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.13e-63G2-like family protein